| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TYW1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TYW1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TYW1. This antibody reacts with human. The TYW1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TYW1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RELVDLIPEYEIACEHEHSNCLLIAHRKFKIGGEWWTWIDYNRFQELIQEYEDSGGSKTFSAKDYMARTPHWALFGANER |
|---|
| Other Names | FLJ10900, MGC23001, MGC60291, Radical S-adenosyl methionine and flavodoxin domain-containing protein 1, radical S-adenosyl methionine and flavodoxin domains 1, RSAFD1, tRNA wybutosine-synthesizing protein 1 homolog, tRNA-yW synthesizing protein 1 homolog (S. cerevisiae), tRNA-yW synthesizing protein 1 homolog A, tRNA-yW-synthesizing protein, TYW1A, YPL207W |
|---|
| Gene, Accession # | TYW1, Gene ID: 55253, SwissProt: Q9NV66 |
|---|
| Catalog # | NBP2-38562 |
|---|
| Price | |
|---|
| Order / More Info | TYW1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|