| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TYW3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TYW3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TYW3. This antibody reacts with human. The TYW3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TYW3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EFRKWKAQCLSKADLSRKGSVDEDVVELVQFLNMRDQFFTTSSCAGRILLLDRGINGFEVQKQNCCWLLVTHKLCVKDDVIV |
|---|
| Other Names | C1orf171, chromosome 1 open reading frame 171, EC 2.1.1, EC 2.1.1.-, FLJ40918, tRNA wybutosine-synthesizing protein 3 homolog, tRNA-yW synthesizing protein 3 homolog (S. cerevisiae), tRNA-yW-synthesizing protein 3 |
|---|
| Gene, Accession # | TYW3, Gene ID: 127253 |
|---|
| Catalog # | NBP1-88492 |
|---|
| Price | |
|---|
| Order / More Info | TYW3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|