| Edit |   |
| Antigenic Specificity | TYW5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TYW5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TYW5. This antibody reacts with human. The TYW5 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human C2orf60. Peptide sequence NKDPTAASRAAQILDRALKTLAELPEEYRDFYARRMVLHIQDKAYSKNSE. |
| Other Names | tRNA-yW synthesizing protein 5 |
| Gene, Accession # | TYW5, Gene ID: 129450, Accession: NP_001034782, SwissProt: NP_001034782 |
| Catalog # | NBP1-91416 |
| Price | |
| Order / More Info | TYW5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |