| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TZFP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TZFP Antibody from Novus Biologicals is a rabbit polyclonal antibody to TZFP. This antibody reacts with human. The TZFP Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CPSLASMQAHMRGHSPSQLPPGWTIRSTFLYSSSRPSRPSTSPCCPSSSTT |
|---|
| Other Names | Fanconi anemia zinc finger protein, FAXF, FAZFFANCC-interacting protein, ROG, Testis zinc finger protein, TZFPZinc finger protein 538, zinc finger and BTB domain containing 32, zinc finger and BTB domain-containing protein 32, ZNF538FAXFrepressor of GATA |
|---|
| Gene, Accession # | ZBTB32, Gene ID: 27033 |
|---|
| Catalog # | NBP2-62707 |
|---|
| Price | |
|---|
| Order / More Info | TZFP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|