| 产品详情 |
| Edit |   |
| Antigenic Specificity | TYW1B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TYW1B Antibody from Novus Biologicals is a rabbit polyclonal antibody to TYW1B. This antibody reacts with human. The TYW1B Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TYW1B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RVMSRGEGDCDVVKSKHGSIEANFRAWKTKFISQLQALQKGERKKSCGGHCKKGKCESHQHGSEEREEGSQEQDELHHR |
| Other Names | LINC00069, Long Intergenic Non-Protein Coding RNA 69, NCRNA00069, Non-Protein Coding RNA 69, Radical S-Adenosyl Methionine And Flavodoxin Domain-Containing Protein 2, radical S-adenosyl methionine and flavodoxin domains 1, RSAFD2, S-Adenosyl-L-Methionine-Dependent TRNA 4-Demethylwyosine Synthase, TRNA Wybutosine-Synthesizing Protein 1 Homolog B, TRNA-YW Synthesizing Protein 1 Homolog B, TRNA-YW Synthesizing Protein 1 Homolog B (Non-Protein Coding), TRNA-YW Synthesizing Protein 1 Homolog B (S. Cerevisiae) |
| Gene, Accession # | TYW1B, Gene ID: 441250, SwissProt: Q9NV66 |
| Catalog # | NBP2-38563 |
| Price | |
| Order / More Info | TYW1B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|