| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | U1A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The U1A Antibody from Novus Biologicals is a rabbit polyclonal antibody to U1A. This antibody reacts with human. The U1A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human U1A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPYMP |
|---|
| Other Names | Mud1, small nuclear ribonucleoprotein polypeptide A, U1 snRNP A, U1 snRNP-specific protein A, U1-AU1 small nuclear ribonucleoprotein A, U1AU1 small nuclear RNP-specific A |
|---|
| Gene, Accession # | SNRPA, Gene ID: 6626, Accession: P09012, SwissProt: P09012 |
|---|
| Catalog # | NBP2-33465 |
|---|
| Price | |
|---|
| Order / More Info | U1A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|