| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Aminopeptidase PILS/ARTS1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Aminopeptidase PILS/ARTS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Aminopeptidase PILS/ARTS1. This antibody reacts with human. The Aminopeptidase PILS/ARTS1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Aminopeptidase PILS/ARTS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FQLVSIGKLSIEKALDLSLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRDLIDKQTWTDEGSVSERMLRSQLLLLACVHNYQPCVQRAEGYFRKWKESNGNLS |
|---|
| Other Names | Adipocyte-derived leucine aminopeptidase, A-LAPALAP, Aminopeptidase PILS, ARTS1aminopeptidase regulator of TNFR1 shedding, ARTS-1PILSAP, EC 3.4.11, EC 3.4.11.-, EC 3.4.11.1, endoplasmic reticulum aminopeptidase 1, endoplasmic reticulum aminopeptidase associated with antigen processing, ERAAP1, KIAA0525APPILS, PILS-APERAAP, Puromycin-insensitive leucyl-specific aminopeptidase, Type 1 tumor necrosis factor receptor shedding aminopeptidase regulator |
|---|
| Gene, Accession # | ERAP1, Gene ID: 51752 |
|---|
| Catalog # | NBP2-59005 |
|---|
| Price | |
|---|
| Order / More Info | Aminopeptidase PILS/ARTS1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|