| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CHIP/STUB1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CHIP/STUB1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CHIP/STUB1. This antibody reacts with human. The CHIP/STUB1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CHIP/STUB1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQ |
|---|
| Other Names | Antigen NY-CO-7, Carboxy terminus of Hsp70-interacting protein, CHIPSTIP1 homology and U box-containing protein 1, CLL-associated antigen KW-8, E3 ubiquitin-protein ligase CHIP, EC 6.3.2.-, heat shock protein A binding protein 2 (c-terminal), HSPABP2, NY-CO-7, SDCCAG7, serologically defined colon cancer antigen 7, STIP1 homology and U-box containing protein 1, STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase, UBOX1 |
|---|
| Gene, Accession # | STUB1, Gene ID: 10273 |
|---|
| Catalog # | NBP2-47509 |
|---|
| Price | |
|---|
| Order / More Info | CHIP/STUB1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|