| Edit |   |
|---|
| Antigenic Specificity | Chitinase 3-like 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | n/a |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Chitinase 3-like 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Chitinase 3-like 1. This antibody reacts with human, virus. The Chitinase 3-like 1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | Synthetic peptides corresponding to CHI3L1(chitinase 3-like 1 (cartilage glycoprotein-39)) The peptide sequence was selected from the middle region of CHI3L1. Peptide sequence LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL. |
|---|
| Other Names | AW208766, Brp39, Chi3l1, gp39 |
|---|
| Gene, Accession # | CHI3L1, Gene ID: 1116, Accession: P36222, SwissProt: P36222 |
|---|
| Catalog # | NBP1-57913 |
|---|
| Price | |
|---|
| Order / More Info | Chitinase 3-like 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|