| Edit |   |
|---|
| Antigenic Specificity | Chitobiase/CTBS |
|---|
| Clone | 1B5-1B9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against cell lysate for WB. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Chitobiase/CTBS Antibody (1B5-1B9) from Novus Biologicals is a mouse monoclonal antibody to Chitobiase/CTBS. This antibody reacts with human. The Chitobiase/CTBS Antibody (1B5-1B9) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | CTBS (AAH24007.2, 37 a.a. - 105 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DCPCPEPELCRPIRHHPDFEVFVFDVGQKTWKSYDWSQITTVATFGKYDSELMCYAHSKGARVVLKGNL |
|---|
| Other Names | chitobiase, di-N-acetyl-, CTBdi-N-acetylchitobiase, EC 3.2.1.- |
|---|
| Gene, Accession # | CTBS, Gene ID: 1486, Accession: AAH24007, SwissProt: AAH24007 |
|---|
| Catalog # | H00001486-M01 |
|---|
| Price | |
|---|
| Order / More Info | Chitobiase/CTBS Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|