| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GLIS3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GLIS3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GLIS3. This antibody reacts with human. The GLIS3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human GLIS3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SPGHNVQGSPHNPSSQLPPLTAVDAGAERFAPSAPSPHHISPRRVPAPSSILQRTQPPYTQQPSGSHLKSYQPETNSSFQPNGI |
|---|
| Other Names | FLJ38999, FLJ90578, GLIS family zinc finger 3, GLI-similar 3, OK/KNS-cl.4, zinc finger protein 515, zinc finger protein GLIS3 |
|---|
| Gene, Accession # | GLIS3, Gene ID: 169792, Accession: Q8NEA6, SwissProt: Q8NEA6 |
|---|
| Catalog # | NBP2-33787 |
|---|
| Price | |
|---|
| Order / More Info | GLIS3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 30648929 |
|---|
| 产品资料 |
|
|