| Edit |   |
|---|
| Antigenic Specificity | IQCD |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. For Immunocytochemistry/Immunofluorescence (ICC/IF) Fixation Permeabilization: PFA/Triton X-100 is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IQCD Antibody from Novus Biologicals is a rabbit polyclonal antibody to IQCD. This antibody reacts with human. The IQCD Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human IQCD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EIENWIQKYDTEMGEKQEELEDLDAVHREEKISLEELRRRHKVLVGEFAQIREEREINSKKRMEAEQEMVRMVRA |
|---|
| Other Names | 4933433C09Rik, IQ domain-containing protein D, IQ motif containing D |
|---|
| Gene, Accession # | IQCD, Gene ID: 115811 |
|---|
| Catalog # | NBP2-48916 |
|---|
| Price | |
|---|
| Order / More Info | IQCD Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|