| Edit |   |
| Antigenic Specificity | IQCD |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The IQCD Antibody from Novus Biologicals is a rabbit polyclonal antibody to IQCD. This antibody reacts with human. The IQCD Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to IQCD(IQ motif containing D) The peptide sequence was selected from the N terminal of IQCD. Peptide sequence ALDILAMAPLYQAPAINRIGPKTDPSKRPADPLKPLVLSRTKLTTIEAKR. |
| Other Names | 4933433C09Rik, IQ domain-containing protein D, IQ motif containing D |
| Gene, Accession # | IQCD, Gene ID: 115811, Accession: Q96DY2, SwissProt: Q96DY2 |
| Catalog # | NBP1-56946-20ul |
| Price | |
| Order / More Info | IQCD Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |