| Edit |   |
| Antigenic Specificity | IQCE |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The IQCE Antibody from Novus Biologicals is a rabbit polyclonal antibody to IQCE. This antibody reacts with human. The IQCE Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human IQCEThe immunogen for this antibody is IQCE. Peptide sequence KKMGSALLSLSRSVQELTEENQSLKEDLDRVLSTSPTISKTQGYVEWSKP. |
| Other Names | IQ domain-containing protein E, IQ motif containing E |
| Gene, Accession # | IQCE, Gene ID: 23288, Accession: NP_689771, SwissProt: NP_689771 |
| Catalog # | NBP1-79590-20ul |
| Price | |
| Order / More Info | IQCE Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |