| Edit |   |
| Antigenic Specificity | IQCF1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The IQCF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IQCF1. This antibody reacts with human. The IQCF1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to IQCF1(IQ motif containing F1) The peptide sequence was selected from the middle region of IQCF1. Peptide sequence ATKIKAWWRGTLVRRALLHAALSACIIQCWWRLILSKILKKRRQAALEAF. |
| Other Names | FLJ27508, IQ domain-containing protein F1, IQ motif containing F1, MGC39725 |
| Gene, Accession # | IQCF1, Gene ID: 132141, Accession: Q8N6M8, SwissProt: Q8N6M8 |
| Catalog # | NBP1-60087 |
| Price | |
| Order / More Info | IQCF1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |