| Edit |   |
|---|
| Antigenic Specificity | IQCF1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IQCF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IQCF1. This antibody reacts with human. The IQCF1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to IQCF1(IQ motif containing F1) The peptide sequence was selected from the middle region of IQCF1. Peptide sequence ATKIKAWWRGTLVRRALLHAALSACIIQCWWRLILSKILKKRRQAALEAF. |
|---|
| Other Names | FLJ27508, IQ domain-containing protein F1, IQ motif containing F1, MGC39725 |
|---|
| Gene, Accession # | IQCF1, Gene ID: 132141, Accession: Q8N6M8, SwissProt: Q8N6M8 |
|---|
| Catalog # | NBP1-60087-20ul |
|---|
| Price | |
|---|
| Order / More Info | IQCF1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|