| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Parkin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Recommended conditions for ICC/IF: Fixation/Permeabilization: PFA/Triton X-100, Recommended conditions for IHC: Retrieval method: HIER pH6 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Parkin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Parkin. This antibody reacts with human. The Parkin Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECS |
|---|
| Other Names | E3 ubiquitin ligase, E3 ubiquitin-protein ligase parkin, EC 6.3.2.-, LPRS2, parkin, parkin 2, Parkinson disease protein 2, Parkinson juvenile disease protein 2, parkinson protein 2, E3 ubiquitin protein ligase (parkin), PDJjuvenile) 2, parkin |
|---|
| Gene, Accession # | PRKN, Gene ID: 5071 |
|---|
| Catalog # | NBP2-68629 |
|---|
| Price | |
|---|
| Order / More Info | Parkin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|