| Edit |   |
|---|
| Antigenic Specificity | KLHDC1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KLHDC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KLHDC1. This antibody reacts with human. The KLHDC1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to KLHDC1(kelch domain containing 1) The peptide sequence was selected from the N terminal of KLHDC1. Peptide sequence IDSGLWRMHLMEGELPASMSGSCGACINGKLYIFGGYDDKGYSNRLYFVN. |
|---|
| Other Names | kelch domain containing 1, kelch domain-containing protein 1, MGC126644, MGC126646, MST025 |
|---|
| Gene, Accession # | KLHDC1, Gene ID: 122773, Accession: Q8N7A1, SwissProt: Q8N7A1 |
|---|
| Catalog # | NBP1-55193 |
|---|
| Price | |
|---|
| Order / More Info | KLHDC1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|