| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KLHDC10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. ICC/IF reported in scientific literature (PMID: 26618866). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KLHDC10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KLHDC10. This antibody reacts with human, rat. The KLHDC10 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, rat KLHDC10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EWTQLKPNNLSCDLPEERYRHEIAHDGQRIYILGGGTSWTAYSLNKIHAYNLETNAWEEIATKPHEKIGFPAARRCHSCVQIK |
|---|
| Other Names | kelch domain containing 10, KIAA0265kelch domain-containing protein 10, PNAS-119, scruin like at the midline homolog, slim |
|---|
| Gene, Accession # | KLHDC10, Gene ID: 23008 |
|---|
| Catalog # | NBP1-81528 |
|---|
| Price | |
|---|
| Order / More Info | KLHDC10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26618866 |
|---|
| 产品资料 |
|
|