| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KLHL20 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KLHL20 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KLHL20. This antibody reacts with human. The KLHL20 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human KLHL20 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NIRPGETGMDVTSRCTLGDPNKLPEGVPQPARMPYISDKHPRQTLEVINLLRKHRELCDVVLVVGAKKIYAHRVILSA |
|---|
| Other Names | Kelch motif containing protein, kelch-like 20 (Drosophila), kelch-like ECT2 interacting protein, Kelch-like ECT2-interacting protein, kelch-like protein 20, Kelch-like protein X, KHLHX, KLEIPRP3-383J4.3, KLHLX |
|---|
| Gene, Accession # | KLHL20, Gene ID: 27252, Accession: Q9Y2M5, SwissProt: Q9Y2M5 |
|---|
| Catalog # | NBP2-38708 |
|---|
| Price | |
|---|
| Order / More Info | KLHL20 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|