| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KLHL24 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KLHL24 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KLHL24. This antibody reacts with human. The KLHL24 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human KLHL24 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MVLILGRRLNREDLGVRDSPATKRKVFEMDPKSLTGHEFFDFSSGSSHAENILQIFNEFRDSRLFTDVIICVEG |
|---|
| Other Names | DRE1, Kainate Receptor Interacting Protein For GluR6, Kainate Receptor-Interacting Protein For GluR6, Kelch-Like 24, Kelch-Like 24 (Drosophila), Kelch-Like Family Member 24, Kelch-Like Protein 24, KLHL24, KRIP6, Protein DRE1 |
|---|
| Gene, Accession # | KLHL24, Gene ID: 54800, Accession: Q6TFL4, SwissProt: Q6TFL4 |
|---|
| Catalog # | NBP2-37705 |
|---|
| Price | |
|---|
| Order / More Info | KLHL24 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|