| Edit |   |
|---|
| Antigenic Specificity | KLHL26 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KLHL26 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KLHL26. This antibody reacts with human. The KLHL26 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human KLHL26 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LAVEYYVPETDQWTSVSPMRAGQSEAGCCLLERKIYIVGGYNWRLNNVTGIVQVYNTDTDEWERDLHFPESF |
|---|
| Other Names | Kelch-Like 26, Kelch-Like Family Member 26, Kelch-Like Protein 26 |
|---|
| Gene, Accession # | KLHL26, Gene ID: 55295, Accession: Q53HC5, SwissProt: Q53HC5 |
|---|
| Catalog # | NBP2-34187 |
|---|
| Price | |
|---|
| Order / More Info | KLHL26 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|