| Edit |   |
|---|
| Antigenic Specificity | LZTFL1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LZTFL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LZTFL1. This antibody reacts with human. The LZTFL1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to LZTFL1(leucine zipper transcription factor-like 1) The peptide sequence was selected from the C terminal of LZTFL1. Peptide sequence VQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED. |
|---|
| Other Names | FLJ36386, leucine zipper transcription factor-like 1, leucine zipper transcription factor-like protein 1 |
|---|
| Gene, Accession # | LZTFL1, Gene ID: 54585, Accession: Q9NQ48, SwissProt: Q9NQ48 |
|---|
| Catalog # | NBP1-55520 |
|---|
| Price | |
|---|
| Order / More Info | LZTFL1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|