| 产品详情 |
| Edit |   |
| Antigenic Specificity | LZTR2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LZTR2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LZTR2. This antibody reacts with human. The LZTR2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human LZTR2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SYQSPTMREEYAYGSYYYHGHPQWLQEERVPRQRSPYIWHEDYREQKYLDEHHYENQHSPFGTNSETHFQSNSR |
| Other Names | DKFZp686C2486, FLJ23871, FLJ25761, KIAA1928, Leucine zipper transcription regulator 2FLJ36620, LZTR2SEC16Sprotein SEC16 homolog B, PGPR-p117, protein transport protein Sec16B, Regucalcin gene promoter region-related protein p117, regucalcin gene promotor region related protein, RGPRFLJ33652, RGPR-p117, SEC16 homolog B, SEC16 homolog B (S. cerevisiae) |
| Gene, Accession # | SEC16B, Gene ID: 89866 |
| Catalog # | NBP2-55068 |
| Price | |
| Order / More Info | LZTR2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|