| Edit |   |
| Antigenic Specificity | NEPRO |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NEPRO Antibody from Novus Biologicals is a rabbit polyclonal antibody to NEPRO. This antibody reacts with human. The NEPRO Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to C3ORF17 The peptide sequence was selected from the middle region of C3ORF17. Peptide sequence KLQSTLLREIQQFSQGTRKSATDTSAKWRLSHCTVHRTDLYPNSKQLLNS. |
| Other Names | C3orf17, chromosome 3 open reading frame 17, DKFZP434F2021, hypothetical protein LOC25871, NET17 |
| Gene, Accession # | C3ORF17, Gene ID: 25871, Accession: A8MVI8, SwissProt: A8MVI8 |
| Catalog # | NBP1-59919-20ul |
| Price | |
| Order / More Info | NEPRO Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |