| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LYSMD1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LYSMD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LYSMD1. This antibody reacts with human. The LYSMD1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human LYSMD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PTPIHDLSASDFLKKLDSQISLSKKAAAQKLKKGENGVPGEDAGLHLSSPWMQQRAVLGPVPLTRTSRTRTLRDQEDEIFKL |
|---|
| Other Names | lysM and putative peptidoglycan-binding domain-containing protein 1, LysM, putative peptidoglycan-binding, domain containing 1, MGC35223, RP11-68I18.5, SB145 |
|---|
| Gene, Accession # | LYSMD1, Gene ID: 388695, Accession: Q96S90 |
|---|
| Catalog # | NBP1-81095 |
|---|
| Price | |
|---|
| Order / More Info | LYSMD1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|