| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FAM21A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. Recommended conditions for IHC,Retrieval method: HIER pH6 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAM21A Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM21A. This antibody reacts with human. The FAM21A Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GIQAKTTKPKSRSAQAAPEPRFEHKVSNIFDDPLNAFGGQ |
|---|
| Other Names | Alternative Protein FAM21B, BA56A21.1, bA98I6.1, FAM21B, Family With Sequence Similarity 21 Member A, Family With Sequence Similarity 21, Member A, Family With Sequence Similarity 21, Member B, WASH Complex Subunit FAM21A, WASH Complex Subunit FAM21B |
|---|
| Gene, Accession # | WASHC2A, FAM21A, Gene ID: 387680 |
|---|
| Catalog # | NBP2-68768 |
|---|
| Price | |
|---|
| Order / More Info | FAM21A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|