| Edit |   |
|---|
| Antigenic Specificity | FAM241A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAM241A Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM241A. This antibody reacts with human. The FAM241A Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human C4orf32 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NHTGEPVGDDYKKMGTLFGELNKNLINMGFTRM |
|---|
| Other Names | C4orf32, chromosome 4 open reading frame 32, FLJ39370 |
|---|
| Gene, Accession # | C4ORF32, Gene ID: 132720, Accession: Q8N8J7, SwissProt: Q8N8J7 |
|---|
| Catalog # | NBP2-37990 |
|---|
| Price | |
|---|
| Order / More Info | FAM241A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|