| Edit |   |
|---|
| Antigenic Specificity | FAM36A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAM36A Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM36A. This antibody reacts with human. The FAM36A Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human FAM36AThe immunogen for this antibody is FAM36A. Peptide sequence LGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN. |
|---|
| Other Names | family with sequence similarity 36, member A, FLJ43269 |
|---|
| Gene, Accession # | COX20, Gene ID: 116228, Accession: NP_932342, SwissProt: NP_932342 |
|---|
| Catalog # | NBP1-79529 |
|---|
| Price | |
|---|
| Order / More Info | FAM36A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|