| Edit |   |
| Antigenic Specificity | ANO6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ANO6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ANO6. This antibody reacts with mouse. The ANO6 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to the middle region of Ano6. Immunizing peptide sequence SVFIVFSTTLPKNPNGTDPIQKYLTPQMATSITASIISFIIIMILNTIYE. |
| Other Names | anoctamin 6, anoctamin-6, MGC104751, Transmembrane protein 16FTMEM16FDKFZp313M0720 |
| Gene, Accession # | ANO6, Gene ID: 196527, Accession: Q6P9J9 |
| Catalog # | NBP1-74204 |
| Price | |
| Order / More Info | ANO6 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |