| Edit |   |
|---|
| Antigenic Specificity | ANO6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ANO6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ANO6. This antibody reacts with human. The ANO6 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to ANO6 (anoctamin 6) The peptide sequence was selected from the middle region of ANO6 (NP_001020527). Peptide sequence KSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIV. |
|---|
| Other Names | anoctamin 6, anoctamin-6, MGC104751, Transmembrane protein 16FTMEM16FDKFZp313M0720 |
|---|
| Gene, Accession # | ANO6, Gene ID: 196527, Accession: Q4KMQ2, SwissProt: Q4KMQ2 |
|---|
| Catalog # | NBP1-59655 |
|---|
| Price | |
|---|
| Order / More Info | ANO6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|