| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ANO7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ANO7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ANO7. This antibody reacts with human. The ANO7 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ANO7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VRTGLYCRDQAHAERWAMTSETSSGSHCARSRMLRRRAQEEDSTVLIDVSPPEAEKRGSYGSTAHASEPGGQQ |
|---|
| Other Names | anoctamin 7, Dresden transmembrane protein of the prostate, IPCA-5IPCA5, New gene expressed in prostate, NGEPD-TMPP, PCANAP5anoctamin-7, PCANAP5L, prostate cancer associated protein 5, prostate cancer-associated gene 5, Prostate cancer-associated protein 5, TMEM16GDresden-transmembrane protein of the prostate, Transmembrane protein 16GDTMPP |
|---|
| Gene, Accession # | ANO7, Gene ID: 50636, Accession: Q6IWH7, SwissProt: Q6IWH7 |
|---|
| Catalog # | NBP1-83099 |
|---|
| Price | |
|---|
| Order / More Info | ANO7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|