| Edit |   |
| Antigenic Specificity | Anoctamin 4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Anoctamin 4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Anoctamin 4. This antibody reacts with human. The Anoctamin 4 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Anoctamin 4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ASSSGITNGKTKVFHPEGGVDLQGYQLDMQILPDGPKSDVDFSEILNAIQEMAKDVNILFDELEAVSSPCKDDDSLLHPGNLTSTSDDASRLG |
| Other Names | ANO4, anoctamin-4, FLJ34272, TMEM16D, Transmembrane Protein 16D |
| Gene, Accession # | ANO4, Gene ID: 121601, Accession: Q32M45, SwissProt: Q32M45 |
| Catalog # | NBP2-30727 |
| Price | |
| Order / More Info | Anoctamin 4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |