| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TCF-12/HTF4 |
|---|
| Clone | 2E9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, RNA Inhibition. Antibody reactivity against recominant protein and cell lysate for WB. It has been used for IF, IHC-P, RNAi Validation and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TCF-12/HTF4 Antibody (2E9) from Novus Biologicals is a mouse monoclonal antibody to TCF-12/HTF4. This antibody reacts with human. The TCF-12/HTF4 Antibody (2E9) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, RNA Inhibition. |
|---|
| Immunogen | TCF12 (NP_996919 364 a.a. - 453 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VGSPSPLTGTSQWPRPGGQAPSSPSYENSLHSLKNRVEQQLHEHLQDAMSFLKDVCEQSRMEDRLDRLDDAIHVLRNHAVGPSTSLPAGH |
|---|
| Other Names | BHLHB20, bHLHb20E-box-binding protein, Class B basic helix-loop-helix protein 20, HEBDNA-binding protein HTF4, helix-loop-helix transcription factor 4, HsT17266, HTF4TCF-12, transcription factor 12, Transcription factor HTF-4 |
|---|
| Gene, Accession # | TCF12, Gene ID: 6938, Accession: NP_996919, SwissProt: NP_996919 |
|---|
| Catalog # | H00006938-M01 |
|---|
| Price | |
|---|
| Order / More Info | TCF-12/HTF4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|