| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | B4GALT6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The B4GALT6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to B4GALT6. This antibody reacts with human. The B4GALT6 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human B4GALT6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TTYLPENFTYSPYLPCPEKLPYMRGFLNVNVSEVSFDEIHQLFSKDLDIEPGGHWRPKDCKPRWK |
|---|
| Other Names | B4Gal-T6, beta-1,4-galactosyltransferase 6, Beta-1,4-GalTase 6, Beta4Gal-T6, beta4GalT-VI, EC 2.4.1.-, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6, UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 6, UDP-Gal:glucosylceramide beta-1,4-galactosyltransferase, UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 6 |
|---|
| Gene, Accession # | B4GALT6, Gene ID: 9331, Accession: Q9UBX8, SwissProt: Q9UBX8 |
|---|
| Catalog # | NBP2-37967 |
|---|
| Price | |
|---|
| Order / More Info | B4GALT6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|