| 产品详情 |
| Edit |   |
| Antigenic Specificity | B4GALT5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The B4GALT5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to B4GALT5. This antibody reacts with mouse. The B4GALT5 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to B4galt5 (UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 5) The peptide sequence was selected from the C terminal of B4galt5. Peptide sequence GYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKERQGLDG |
| Other Names | B4Gal-T5, beta-1,4-galactosyltransferase 5, Beta-1,4-GalT II, beta-1,4-GalT IV, Beta-1,4-GalTase 5, beta-1.4-galactosyltransferase V, beta4-GalT IV, Beta4Gal-T5, BETA4-GALT-IV, beta4GalT-V, EC 2.4.1.-, gt-V, MGC138470, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5, UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 5, UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 5, UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 5 |
| Gene, Accession # | B4GALT5, Gene ID: 9334, Accession: Q9JMK0 |
| Catalog # | NBP1-69018-20ul |
| Price | |
| Order / More Info | B4GALT5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|