| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | B3GAT2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The B3GAT2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to B3GAT2. This antibody reacts with mouse. The B3GAT2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to B3gat2 (beta-1,3-glucuronyltransferase 2 (glucuronosyltransferase S)) The peptide sequence was selected from the C terminal of B3gat2. Peptide sequence SDFLKQITTVEELEPKASNCTKVLVWHTRTEKVNLANEPKYHLDTVNIEV. |
|---|
| Other Names | Beta-1,3-glucuronyltransferase 2, beta-1,3-glucuronyltransferase 2 (glucuronosyltransferase S), EC 2.4.1.135, GlcAT-D, GlcAT-S, GLCATSgalactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 2, Glucuronosyltransferase S, KIAA1963glcAT-D, MGC138535, UDP-glucuronosyltransferase S, UDP-glucuronyltransferase S, uridine diphosphate glucuronic acid:acceptor glucuronosyltransferase |
|---|
| Gene, Accession # | B3GAT2, Gene ID: 135152, Accession: P59270 |
|---|
| Catalog # | NBP1-68910 |
|---|
| Price | |
|---|
| Order / More Info | B3GAT2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|