| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | B3GNT8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The B3GNT8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to B3GNT8. This antibody reacts with human. The B3GNT8 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human B3GNT8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TPANPEPTLPANLSTRLGQTIPLPFAYWNQQQWRLGSLPSGDSTETGGCQAWGAAAATEIPDFASYPKDLRRFLLSAACRSFPQWLP |
|---|
| Other Names | B3GALT7, Beta Galactosyltransferase BGALT15, beta-1,3-Gn-T8, beta-1,3-N-acetylglucosaminyltransferase 8, Beta1,3-N-Acetylglucosaminyltransferase 8, beta3Gn-T8, BGALT15, BGnT-8, EC 2.4.1.-, UDP-Gal:BetaGal Beta 1,3-Galactosyltransferase Polypeptide 7, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 |
|---|
| Gene, Accession # | B3GNT8, Gene ID: 374907, Accession: Q7Z7M8, SwissProt: Q7Z7M8 |
|---|
| Catalog # | NBP2-33400 |
|---|
| Price | |
|---|
| Order / More Info | B3GNT8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|