| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | B3GNT9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The B3GNT9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to B3GNT9. This antibody reacts with human. The B3GNT9 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human B3GNT9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ELVVVHGLSAADIWLMWRLLHGPHGPACAHPQPVAAGPFQWDS |
|---|
| Other Names | beta-1,3-galactosyltransferase-related protein, Beta-1,3-Gn-T9, Beta-1,3-N-acetylglucosaminyltransferase 9, Beta3Gn-T9, BGnT-9, EC 2.4.1.-, MGC4655, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9 |
|---|
| Gene, Accession # | B3GNT9, Gene ID: 84752, Accession: Q6UX72, SwissProt: Q6UX72 |
|---|
| Catalog # | NBP2-30427 |
|---|
| Price | |
|---|
| Order / More Info | B3GNT9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|