| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | B3GNTL1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Western blot reported in scientific literature (PMID 26104473) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The B3GNTL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to B3GNTL1. This antibody reacts with human. The B3GNTL1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human B3GNTL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ASEESQAMQAHVSIILPVHNAEPWLDECLRSVLQQDFEGTMELSVFNDASKDKSGAIIEKWRVKLEDSGVHVIIGGHDSPSP |
|---|
| Other Names | B3GNT8, beta-1,3-Gn-T8, beta-1,3-N-acetylglucosaminyltransferase 8, beta1,3-N-acetylglucosaminyltransferase-like protein 1, beta3Gn-T8, beta3GnTL1, beta3Gn-T-like protein 1, BGnT-8, BGnT-like protein 1, MGC126253, MGC126256, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase-like 1, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase-like protein 1 |
|---|
| Gene, Accession # | B3GNTL1, Gene ID: 146712 |
|---|
| Catalog # | NBP1-90838 |
|---|
| Price | |
|---|
| Order / More Info | B3GNTL1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26104473 |
|---|
| 产品资料 |
|
|