| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | B7-H4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The B7-H4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to B7-H4. This antibody reacts with human. The B7-H4 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human B7-H4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRL |
|---|
| Other Names | B7h.5, B7-H4, B7H4T-cell costimulatory molecule B7x, B7S1VCTN1, B7XPRO1291, FLJ22418, Immune costimulatory protein B7-H4, Protein B7S1, T cell costimulatory molecule B7x, V-set domain containing T cell activation inhibitor 1, V-set domain-containing T-cell activation inhibitor 1 |
|---|
| Gene, Accession # | VTCN1, Gene ID: 79679, Accession: Q7Z7D3, SwissProt: Q7Z7D3 |
|---|
| Catalog # | NBP2-30536 |
|---|
| Price | |
|---|
| Order / More Info | B7-H4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 27073557, 27764786 |
|---|
| 产品资料 |
|
|