| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FADS1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FADS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FADS1. This antibody reacts with human. The FADS1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human FADS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GSRVISHYAGQDATDPFVAFHINKGLVKKYMNSLLIGELSPEQPSFEPTKNKELTDEFRELRATVERMGLMKANH |
|---|
| Other Names | D5DFLJ90273, Delta(5) desaturase, Delta(5) fatty acid desaturase, Delta-5 desaturase, delta-5 fatty acid desaturase, EC 1.14.19, EC 1.14.19.-, FADS6, FADSD5LLCDL1, fatty acid desaturase 1, FLJ38956, linoleoyl-CoA desaturase (delta-6-desaturase)-like 1, TU12 |
|---|
| Gene, Accession # | FADS1, Gene ID: 3992 |
|---|
| Catalog # | NBP1-84312 |
|---|
| Price | |
|---|
| Order / More Info | FADS1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|