| Edit |   |
| Antigenic Specificity | NT5C3L |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NT5C3L Antibody from Novus Biologicals is a rabbit polyclonal antibody to NT5C3L. This antibody reacts with rat. The NT5C3L Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is LOC100364937 - C-terminal region. Peptide sequence FKGQLIHTYNKNSSVCENSSYFQQLRNKTNIILLGDSIGDLTMADGVPGV. |
| Other Names | 5'-nucleotidase, cytosolic III-like |
| Gene, Accession # | NT5C3L, Gene ID: 115024, Accession: XP_002724687 |
| Catalog # | NBP1-98260-20ul |
| Price | |
| Order / More Info | NT5C3L Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |