| Edit |   |
|---|
| Antigenic Specificity | NT5C3L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NT5C3L Antibody from Novus Biologicals is a rabbit polyclonal antibody to NT5C3L. This antibody reacts with rat. The NT5C3L Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is LOC100364937 - C-terminal region. Peptide sequence FKGQLIHTYNKNSSVCENSSYFQQLRNKTNIILLGDSIGDLTMADGVPGV. |
|---|
| Other Names | 5'-nucleotidase, cytosolic III-like |
|---|
| Gene, Accession # | NT5C3L, Gene ID: 115024, Accession: XP_002724687 |
|---|
| Catalog # | NBP1-98260 |
|---|
| Price | |
|---|
| Order / More Info | NT5C3L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|