| Edit |   |
|---|
| Antigenic Specificity | NT5DC2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NT5DC2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NT5DC2. This antibody reacts with human. The NT5DC2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to NT5DC2 (5'-nucleotidase domain containing 2) The peptide sequence was selected from the N terminal of NT5DC2. Peptide sequence IRKYDYNPSFAIRGLHYDIQKSLLMKIDAFHYVQLGTAYRGLQPVPDEEV. |
|---|
| Other Names | 5'-nucleotidase domain containing 2 |
|---|
| Gene, Accession # | NT5DC2, Gene ID: 64943 |
|---|
| Catalog # | NBP1-70660-20ul |
|---|
| Price | |
|---|
| Order / More Info | NT5DC2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|