| Edit |   |
| Antigenic Specificity | SETD9 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SETD9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SETD9. This antibody reacts with human. The SETD9 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to C5ORF35 The peptide sequence was selected from the N terminal of C5ORF35. Peptide sequence QSEILTMLPESVKSKYQDLLAVEHQGVKLRENRHQQQSTFKPEEILYKTL. |
| Other Names | C5orf35, chromosome 5 open reading frame 35, hypothetical protein LOC133383, MGC33648, SET domain containing 9 |
| Gene, Accession # | SETD9, Gene ID: 133383, Accession: Q8NE22, SwissProt: Q8NE22 |
| Catalog # | NBP1-56742 |
| Price | |
| Order / More Info | SETD9 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |