| Edit |   |
| Antigenic Specificity | CDC42EP4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CDC42EP4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CDC42EP4. This antibody reacts with human. The CDC42EP4 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CDC42EP4(CDC42 effector protein (Rho GTPase binding) 4) The peptide sequence was selected from the N terminal of CDC42EP4. Peptide sequence SSSKRSLLSRKFRGSKRSQSVTRGEREQRDMLGSLRDSALFVKNAMSLPQ. |
| Other Names | BORG4MGC3740, CDC42 effector protein (Rho GTPase binding) 4, cdc42 effector protein 4, CEP4Binder of Rho GTPases 4, KAIA1777, MGC17125 |
| Gene, Accession # | CDC42EP4, Gene ID: 23580, Accession: Q9H3Q1, SwissProt: Q9H3Q1 |
| Catalog # | NBP1-53150 |
| Price | |
| Order / More Info | CDC42EP4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |