| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CD117/c-kit |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CD117/c-kit Antibody from Novus Biologicals is a rabbit polyclonal antibody to CD117/c-kit. This antibody reacts with human. The CD117/c-kit Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human CD117/c-kit antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNEYMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELAL |
|---|
| Other Names | CD117, CD117 antigen, ckit, C-Kit, EC 2.7.10, EC 2.7.10.1, PBT, piebald trait, Proto-oncogene c-Kit, proto-oncogene tyrosine-protein kinase Kit, SCFRmast/stem cell growth factor receptor, soluble KIT variant 1, Tyrosine-protein kinase Kit, v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog, v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene-like protein |
|---|
| Gene, Accession # | KIT, Gene ID: 3815 |
|---|
| Catalog # | NBP2-57890 |
|---|
| Price | |
|---|
| Order / More Info | CD117/c-kit Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|