| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | espin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The espin Antibody from Novus Biologicals is a rabbit polyclonal antibody to espin. This antibody reacts with human, mouse, rat. The espin Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat espin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SMPAWRRDLLRKKLEEEREQKRKEEERQKQEELRREKEQSEKLRTLGYDESKLAPWQRQVILKK |
|---|
| Other Names | autosomal recessive deafness type 36 protein, DKFZp434A196, DKFZp434G2126, espin |
|---|
| Gene, Accession # | ESPN, Gene ID: 83715, Accession: B1AK53, SwissProt: B1AK53 |
|---|
| Catalog # | NBP1-90588 |
|---|
| Price | |
|---|
| Order / More Info | espin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 30101840, 30467855 |
|---|
| 产品资料 |
|
|