| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MAPK1IP1L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MAPK1IP1L Antibody from Novus Biologicals is a rabbit polyclonal antibody to MAPK1IP1L. This antibody reacts with human. The MAPK1IP1L Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MAPK1IP1L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: APPVPWGTVPPGAWGPPAPYPAPTGSYPTPGLYPTPSNPFQVPSGPSGAPPMPGG |
|---|
| Other Names | c14_5346, C14orf32, chromosome 14 open reading frame 32, MAPK-interacting and spindle-stabilizing protein, MAPK-interacting and spindle-stabilizing protein-like, MGC23138, MISS, mitogen activated protein kinase 1 interacting protein 1-like, mitogen-activated protein kinase 1 interacting protein 1-like, Mitogen-activated protein kinase 1-interacting protein 1-like |
|---|
| Gene, Accession # | MAPK1IP1L, Gene ID: 93487 |
|---|
| Catalog # | NBP1-88420 |
|---|
| Price | |
|---|
| Order / More Info | MAPK1IP1L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|